Yassinderraz.com
Domain Summary
What is the traffic rank for Yassinderraz.com?
• Yassinderraz.com ranks #7,097,653 globally on HypeStat.
What percent of global Internet users visit Yassinderraz.com?
• 1.0E-7% of global Internet users visit Yassinderraz.com
How many people visit Yassinderraz.com each day?
• Yassinderraz.com receives approximately 7 visitors and 8 page impressions per day.
Which countries does Yassinderraz.com receive most of its visitors from?
• Yassinderraz.com is mostly visited by people located in Morocco.
How much Yassinderraz.com can earn?
• Yassinderraz.com should earn about $0.01/day from advertising revenue.
What is Yassinderraz.com estimated value?
• Estimated value of Yassinderraz.com is $3.86.
What IP addresses does Yassinderraz.com resolve to?
• Yassinderraz.com resolves to the IP addresses 199.59.243.225.
Where are Yassinderraz.com servers located in?
• Yassinderraz.com has servers located in United States.
yassinderraz.com Profile
Description:موقع yassin derraz ياسين الدراز للعلوم الفيزيائية
Category:Science and Education / Education
yassinderraz.com Traffic Analysis
Yassinderraz.com is ranked #7,097,653 in the world. This website is viewed by an estimated 7 visitors daily, generating a total of 8 pageviews. This equates to about 212.1 monthly visitors.Daily Visitors7
Monthly Visits212.1
Pages per Visit1.28
Visit duration n/a
Bounce Rate69.00%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 7
- Monthly Visits:
- 212
- Pages per Visit:
- 1.28
- Daily Pageviews:
- 8
- Avg. visit duration:
- n/a
- Bounce rate:
- 69.00%
- Global Reach:
- 1.0E-7%
- Monthly Visits (SimilarWeb):
- 201
- HypeRank:
- 7,097,653
- SimilarWeb Rank:
- 15,192,459
Total Visits Last 3 Months
213
JUL
212.1
AUG
212.1
SEP
Visitors by country
- Country
- Users%
- Morocco 100.00%
Backlinks Report ▼
Yassinderraz.com has a total of 85 backlinks from 9 referring domains and most of them comes from United States.- Total Backlinks:
- 85
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 9
- Referring IPs:
- 13
- Authority Domain Score:
- 6
Backlinks by country
- Country
- Domains
- United States 2
- Singapore 2
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 7
- .work
- 1
- .in
- 1
- .edu
- 0
- .gov
- 0
Which sites are competitors to yassinderraz.com?
Websites similar to yassinderraz.com are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- capres.ca
- Compare >5
Last update was 458 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with yassinderraz.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 2
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- yassinderraz.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $0 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $0.3 and annual gross revenue of approximately $3.7. Based on these figures, the site's net worth is estimated at around $3.9.How much would yassinderraz.com make?
- Daily Revenue:
- $0.01
- Monthly Revenue:
- $0.30
- Yearly Revenue:
- $3.65
Daily earning by country
- CountryPageviewsEarning
- Morocco 8$0.00
Daily revenue loss by country
- CountryBlockedLost Money
- Morocco 0$0.00
How much is yassinderraz.com worth?
- Website Value:
- $3.9
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- yassinderraz.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- yassinderraz.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- yassinderraz.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is yassinderraz.com hosted? ▼
Yassinderraz.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 199.59.243.225
- ASN:
- AS16509
- ISP:
- Amazon.com, Inc.
- Server Location:
United States, US
Other sites hosted on 199.59.243.225
How fast does yassinderraz.com load? ▼
The average loading time of yassinderraz.com is 85 ms.- Average Load Time:
- 85 ms
Does yassinderraz.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on yassinderraz.com are reduced by %.
yassinderraz.com does not use compression.
Original size: 1.04 KB
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. yassinderraz.com supports HTTPS. yassinderraz.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: yassinderraz.com
Organization:
Location:
Issuer: E1
Valid from: Aug 15 23:21:23 2023 GMT
Valid until: Nov 13 23:21:22 2023 GMT
Authority: CA:FALSE
Keysize:
Organization:
Location:
Issuer: E1
Valid from: Aug 15 23:21:23 2023 GMT
Valid until: Nov 13 23:21:22 2023 GMT
Authority: CA:FALSE
Keysize:
Common Name: E1
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X2
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize:
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X2
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize:
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. yassinderraz.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Date: Thu, 12 Oct 2023 15:53:01 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 1069
X-Request-Id: 449c32e7-efc1-41bf-a332-0a832de48822
Cache-Control: no-store, max-age=0
Accept-Ch: sec-ch-prefers-color-scheme
Critical-Ch: sec-ch-prefers-color-scheme
Vary: sec-ch-prefers-color-scheme
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBANDrp2lz7AOmADaN8tA50LsWcjLFyQFcb/P2Txc58oYOeILb3vBw7J6f4pamkAQVSQuqYsKx3YzdUHCvbVZvFUsCAwEAAQ==_bwjDaH+e7E6ubioCe6l6rPCz9Q1KqE/LTqv+lCeRX3VgZ3V4oh/NM35/7uEpSIkG8VvMgUhNUSlUSfEXDpLU6w==
Set-Cookie: parking_session=449c32e7-efc1-41bf-a332-0a832de48822; expires=Thu, 12 Oct 2023 16:08:01 GMT; path=/
Connection: close
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 10800 | ||
Mname | ns1.bodis.com | ||
Rname | dnsadmin.bodis.com | ||
Serial Number | 2017062202 | ||
Refresh | 10800 | ||
Retry | 3600 | ||
Expire | 1209600 | ||
Minimum TTL | 3600 | ||
A | 199.59.243.225 | 10723 | |
NS | 600 | ||
NS | 600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on February 16, 2023 and will expire on February 16, 2024 if not renewed. This website is now assigned through the registrar DropCatch.com 1362 LLC. The WHOIS data for this website's domain was last updated on February 16, 2023.- Domain Created:
- 2023-02-16
- Domain Expires:
- 2024-02-16
- Domain Updated:
- 2023-02-16
- Domain Age:
- 1 years 10 months 24 days
- Domain Registrar:
- DropCatch.com 1362 LLC
- Domain Owner:
- Redacted for GDPR privacy
- WhoIs:
Domain Name: YASSINDERRAZ.COM Registry Domain ID: 2759000979_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.NameBright.com Registrar URL: https://www.NameBright.com Updated Date: 2023-02-16T20:00:03.944Z Creation Date: 2023-02-16T19:28:07.000Z Registrar Registration Expiration Date: 2024-02-16T19:28:07.000Z Registrar: DropCatch.com 1362 LLC Registrar IANA ID: 3571 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.7204960020 Domain Status: ok https://www.icann.org/epp#ok Registry Registrant ID: Not Available From Registry Registrant Name: Redacted for GDPR privacy Registrant Organization: Redacted for GDPR privacy Registrant Street: Redacted for GDPR privacy, Redacted for GDPR privacy Registrant City: Redacted for GDPR privacy Registrant State/Province: BP Registrant Postal Code: Redacted for GDPR privacy Registrant Country: HU Registrant Phone: Redacted for GDPR privacy Registrant Phone Ext: Registrant Fax: Redacted for GDPR privacy Registrant Fax Ext: Registrant Email: Registry Admin ID: Not Available From Registry Admin Name: Redacted for GDPR privacy Admin Organization: Redacted for GDPR privacy Admin Street: Redacted for GDPR privacy, Redacted for GDPR privacy Admin City: Redacted for GDPR privacy Admin State/Province: Redacted for GDPR privacy Admin Postal Code: Redacted for GDPR privacy Admin Country: Redacted for GDPR privacy Admin Phone: Redacted for GDPR privacy Admin Phone Ext: Admin Fax: Redacted for GDPR privacy Admin Fax Ext: Admin Email: Registry Tech ID: Not Available From Registry Tech Name: Redacted for GDPR privacy Tech Organization: Redacted for GDPR privacy Tech Street: Redacted for GDPR privacy, Redacted for GDPR privacy Tech City: Redacted for GDPR privacy Tech State/Province: Redacted for GDPR privacy Tech Postal Code: Redacted for GDPR privacy Tech Country: Redacted for GDPR privacy Tech Phone: Redacted for GDPR privacy Tech Phone Ext: Tech Fax: Redacted for GDPR privacy Tech Fax Ext: Tech Email: Name Server: NS1.BODIS.COM Name Server: NS2.BODIS.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-02-16T20:00:03.944Z